ChemicalBook

A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z

Description CAS Number Molecular Formula
FAM-DDGTP
FAME Column Evaluation Mix
6-FAM-D(OME)E(OME)VD(OME)-FMK C43H45FN4O16
5-FAM-DRRKKLTQ(K-DABCYL)-AMIDE C85H117N23O20
FAME-20H KIT 22
FAME-30H KIT 23
FAME?Kit?21
FAME?Kit?23
FAME?Kit?22
FAME?Kit?24
5-FAM-ELEF-PY-MDYE-NH2 C78H87N10O28PS
F.A.M.E. Mix, C4-C24 Unsaturates
F.A.M.E. Mix, C8-C22 Unsaturates
F.A.M.E. Mix RM-1, Oil Reference Standard, AOCS No. 1
F.A.M.E. Mix Rapeseed Oil, Rapeseed oil mixture
Fame 22:4n-6 C23H38O2
5-FAM-END-PY-INASL C65H78N11O27P
F.A.M.E. RM-3 mixture, Oil Reference Standard, AOCS No. 3
F.A.M.E. RM-4 mixture, Oil Reference Standard, AOCS No. 4
F.A.M.E. RM-5 mixture, Oil Reference Standard, AOCS No. 5
5-FAM-ERMRPRKRQGSVRRRV C104H165N39O27S
F.A.M.E. RM-2 mixture, Oil Reference Standard, AOCS No. 2
F.A.M.E. RM-6 mixture, Oil Reference Standard, AOCS No. 6
FA-MET-OH 261179-09-3 C12H15NO4S
5-FAM-EVNLDAFK(QXL(TM) 520)
5-FAM-HATPPKKKRK C74H105N19O18
FAM-GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-VAL-GLY-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-ASN-GLY-LEU-THR-SER-LYS(BIOTIN)-OH
5-FAM-GLY-ARG-PRO-ARG-THR-SER-SER-PHE-ALA-GLU-GLY-OH C69H87N17O23
FAM-GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-VAL-GLY-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-ASN-GLY-LEU-THR-SER-OH
5-FAM-GLY-PRO-HIS-ARG-SER-THR-PRO-GLU-SER-ARG-ALA-ALA-VAL-OH C77H103N21O25
FAM-GLY-SER-[SER(N-OCTANOYL)]-PHE-LEU-SER-PRO-GLU-HIS-GLN-ARG-VAL-GLN-GLN-ARG-LYS-GLU-SER-LYS-LYS-PRO-PRO-ALA-LYS-LEU-GLN-PRO-ARG-OH C168H250N46O52
5-FAM-GLN-LYS-ARG-PRO-ARG-ARG-LYS-ASP-THR-PRO-OH C74H106N22O21
FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
FAM-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-LYS(BIOTIN)-NH2
FAM-HIS-SER-ASP-ALA-VAL-PHE-THR-ASP-ASN-TYR-THR-ARG-LEU-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ASN-SER-ILE-LEU-ASN-LYS(BIOTIN)-NH2
FAM-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-OH C174H235N43O55S
FAM-HIS-SER-ASP-GLY-THR-PHE-THR-SER-GLU-LEU-SER-ARG-LEU-ARG-GLU-GLY-ALA-ARG-LEU-GLN-ARG-LEU-LEU-GLN-GLY-LEU-VAL-LYS(BIOTIN)-OH
FAM-HIS-SER-ASP-ALA-VAL-PHE-THR-ASP-ASN-TYR-THR-ARG-LEU-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ASN-SER-ILE-LEU-ASN-NH2
FAM-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2
FALSE CHINESE SWERTIA HERB PLANT EXTRACT
FALSEINDIGO
FALSESOUR CHERRY PLANT EXTRACT
FALSEHELLEBORE ROOT AND RHIZOME PLANT EXTRACT
FamirapriniumChloride
5-FAM-KKALHRQETVDAL C86H123N21O26
5-FAM-KKALRRQETVDAL C86H128N22O26
5-FAM-KKRFSFKKSFKL C96H132N20O21
Fananserin 127625-29-0
5-FAM-LEU-ARG-ARG-ALA-SER-LEU-GLY-OH C53H71N13O15
5-FAM-KQAEAVTSPR C66H89N15O22
5-FAM-KRREILSRRPSYR C94H139N29O25
5-FAM-KRELVEPLTPSGEAPNQALLR-NH2 C122H183N31O37
5-FAM-KVEKIGEGTYGVVYK C98H134N18O29
5-FAM-MET-HIS-ARG-GLN-GLU-THR-VAL-ASP-CYS-LEU-LYS-NH2 C76H105N19O23S2
5-FAM MMP FRET PEPTIDE FLUORESCENCE STANDARD I C32H30N2O9
5-FAM LYS C27H24N2O8
FAM-NHS ACTIVATED DYE
FAM-MTERT, AS, SODIUM SALT
Fandofloxacin 164151-00-2
Fancy tallow
F5 ( 4-ANDROSTEN-3-ONE-17BETA-CARBOXYLIC ACID )
FAM-PAEDMARYYSALRHYINLITRQRY-NH2 C155H217N41O42S
FAM-P53AS, CONTROL, SODIUM SALT
FAMPHUR 52-85-7 C10H16NO5PS2
FAMPHUR-O-ANALOG 960-25-8 C10H16NO6PS
FA-LYS-ALA-OH 158016-07-0 C16H23N3O5
FA-LYS-LEU-OH 158016-09-2 C19H29N3O5
FAMOTIDINE-13C1 C8H15N7O2S3
FAMOTIDINE DEGRADATION IMPURITY 1 BP(CRM STANDARD) C8H15N7O2S3
FAMOTIDINE IMPURITY B3,5-BIS[2-[[[2-[(DIAMINOMETHYLENE)AMINO] THIAZOL-4-YL]METHYL]THIO]-ETHYL]-4H-1,2,4,6-THIATRIAZINE1,1-DIOXIDE EPF(CRM STANDARD) C8H15N7O2S3
Fanetizole 79069-94-6 C17H16N2S
FAMOTIDINE EPF(CRM STANDARD)
FAMOTIDINE USP(CRM STANDARD) C8H15N7O2S3
FAMOTIDINE BP STANDARD(CRM STANDARD)
FAMOTIDINE IMPURITY A C8H15N7O2S3
FAMOTIDINE IMPURITY D C8H15N7O2S3
FAMOTIDINE'S INTERMEDIATE
FAMOTIDINE (125 MG) Q_LINE
Famotidine-15N2-13C C8H15N7O2S3
FAMOTIDINE FOR SYSTEM SUITABILITY C8H15N7O2S3
Famotidine-d4 C8H11N7O2S3D4
FAMOTIDINE-13C3 C8H15N7O2S3
Famotidine dispersible tablets
FAMOTIDINE DEGRADATION IMPURITY 2 BP STANDARD(CRM STANDARD) C8H15N7O2S3
FAMOTIDINE IMPURITY C BP STANDARD(CRM STANDARD) C8H15N7O2S3
Famotidine 76824-35-6 C8H15N7O2S3
FAMOTIDINE DEGRADATION IMPURITY 2 BP(CRM STANDARD) C8H15N7O2S3
FAMOTIDINE IMPURITY C BP(CRM STANDARD) C8H15N7O2S3
FAMOTIN
FAMOTIDINE IMPURITY B C8H15N7O2S3
FAMOTIDINE DEGRADATION IMPURITY 1 BP STANDARD(CRM STANDARD) C8H15N7O2S3
FAMOTIDINE IMPURITY A3-[[[2-[(DIAMINOMETHYLENE)AMINO]THIAZOL-4-YL]METHYL]-THIO]PROPANAMIDE EPF(CRM STANDARD) C8H15N7O2S3
Famotine 18429-78-2
Famotidine Injection
5-FAM-PKTPKKAKKL C74H109N15O18
5-FAM-PLSRTLSVAAKK-NH2 C77H114N18O21
5-FAM-PLSRTLSVSS-NH2 C65H90N14O21
5-FAM-PLARTLSVAGLPGKK C89H132N20O24
(+)-FANGCHINOLINE 436-77-1 C37H40N2O6
FANGCHINOLINE >90 BY HPLC
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74

Copyright 2007©  ChemicalBook. All rights reserved.