ChemicalBook

A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z

Description CAS Number Molecular Formula
DABOIA RUSSELII SIAMENSIS (THAILAND)
dacemazine 518-61-6
3'-DA CEP 207347-42-0 C47H52N7O7P
Dab1, phosphorylated (Tyr220) (Disabled 1)
Dab1, phosphorylated (Tyr198) (Disabled 1)
Dab1, phosphorylated (Ser491) (Disabled 1)
DAB-PIP C9H19N3O
D-3-ACETYTHIO-2-METHYLPROPINYL-L-PROLINE
1-(D-3-ACETYLTHIO-2-METHYLPROPANOYL)-L-PROLINE C11H17NO4S
D-3-ACETYLTHIO-2-METHYL PROPIONYL-L-PROLINE (D-AMINE) C11H19N2O4S
D-(-)-3-Acetylthio-2-methylpropionic acid 76497-39-7 C6H10O3S
DAB(POLYMER),KIT
DABQUICKENHANCERSOLUTION,FORINTENSIFYINGDABSTAINS
DACIA C14H15IN2O3
2,4-DAcidTech.95Min
2,4-D Acid Tech
DABTABLETS,FIZZING,UNBUFFERED,DISSOLVESINBUFFERIN3MIN.
DABTABLETSFORPEROXIDASE
DABTABLETS,FIZZING,BUFFERED,PH5.0,FORIB,DISSOLVESINDI-H2OIN3MIN.
DABTABLETS,FIZZING,BUFFERED,PH7.0:IH,DISSOLVESINDI-H2O<5MIN.TOGIVE1MG./ML.CONC.
dacisteine 18725-37-6 C7H11NO4S
DAB SUBSTRATE BUFFER
DAB substrate (brown), for HRP, Staining Kit for LM,Membranes (incl:DAB,buf.,HRP sol.),liq.-droppers
DAB SUBSTRATE METAL ENHANCED
DABSYL-L-METHIONINE 97684-99-6 C19H24N4O4S2
DABSYL HYDRAZINE 72565-41-4 C14H17N5O2S
DABSYL-GLYCINE 89131-05-5 C16H18N4O4S
3'-DABSYL CPG
DABSYL-L-TRYPTOPHAN 97685-00-2 C25H25N5O4S
DABSYLAMINOETHYL METHANETHIOSULFONATE C17H22N4O4S3
DABSYL-L-LEUCINE 89131-12-4 C20H26N4O4S
DABSYL CHLORIDE 56512-49-3 C14H14ClN3O2S
DABSYL-L-ALANINE 89131-10-2 C17H20N4O4S
DABSYL-L-PROLINE 89131-09-9 C19H22N4O4S
DABSYL-L-VALINE 89131-11-3 C19H24N4O4S
DAB TRIS TABLET C16H29Cl4N5O3
Dabur
10-Dab98Usd
DACM 55145-14-7 C16H14N2O4
Dacliximab 152923-56-3
DAD-7 conductive adhesive
DADE C23H44N3O6P
dA(bz) CPG 500
dA(bz) CPG
dA(bz) CPG 1000
DA(BZ) DERIVATIZED CPG
DADEPYLIPQQG C54H82N13O24P
DADE-PY-LIPQQGFF C72H100N15O26P
DADE-PY-L C31H45N6O17P
3'-DA CPG
DA(BZ) PHOSPHORAMIDITE DA(BZ)
DA(BZ) PHOSPHORAMIDITES
dA(bz) Phosphoramidite
DACRENE 20070-61-5
DACRON SEPARATOR 124MM 100/PK
DACRON POWDER
DACRON SEPARATOR 26MM 50/PK
DACRON SEPARATOR 35MM 50/PK
DACRON SEPARATOR 22MM 50/PK
DACRON SEPARATOR 75MM 25/PK
DACRON SEPARATOR 37MM 50/PK
DACRON SEPARATOR 16MM 50/PK
DACRON SEPARATOR 75MM 50/PK
DACRON SEPARATOR 257MM 25/PK
DACRON SEPARATOR 124MM 25/PK
D-(-)-A-DIHYDROPHENYL GLYCINEDANE SALT METHYL SODIUM
3-Dadht 99447-37-7
DACTINOMYCIN USP(CRM STANDARD)
DAEAA/ 3-(N,N-Diacetoxyethyl) Amino Acetanilide/
dactylocycline E 146064-01-9
Dactylfungin A 146935-35-5
Dactylfungin B 146935-36-6
DACTYLICAPNOS ROOT PLANT EXTRACT
dacuronium bromide 27115-86-2 C10H50Br10N20O10
D-A-(1,4-CYCLOHEXADIENYL) GLYCINE
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-NLE-VGGVV
DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-NLE-VGGVVIA
DAF-2 DA **NOT FOR SALE IN JAPAN**
DAF:CLONE:RIK0-3,HAMSTERANTI-MOUSE:BIOTIN
DAF:CLONE:RIK0-3,HAMSTERANTI-MOUSE:FITC
DAF:CLONE:RIK0-3,HAMSTERANTI-MOUSE:PE
DAF:CLONE:RIK0-3,HAMSTERANTI-MOUSE
Daemonorops draco, ext. 84776-31-8
DAF-FM C21H14F2N2O5
DAF-FM DA**NOT AVAILABLE FOR SALE IN JAPAN**
DAF-FM DA C25H18F2N2O7
DAF-FM**NOT AVAILABLE FOR SALE IN JAPAN**
DAFFODIL LECTIN
DAFFODIL LECTIN, BIOTINYLATED
D(-)-A-(4-ETHYL-2,3-DIOXO-1-PIPERAZINYL)-CARBOXAMIDO-4-PHENYL ACETIC ACID
D-(-)-A-[4-ETHYL-2,3-DIOXO-1-PIPERAZINE (CARBOXAMIDO)]-A-4-HYDROXY PHENYL ACETIC ACID
D(+)-A-ETHYLBENZYLAMINE C9H13N
Dagapamil 85247-76-3 C36H56N2O4
DAF-2 **NOT FOR SALE IN JAPAN**
DAGHESTAN SWEETCLOVER HERB PLANT EXTRACT
DAF-2T
DAF-2T *NOT AVAILABLE FOR SALE IN JAPAN*
DAGO 78123-71-4 C26H35N5O6
DAGO ACETATE SALT 100929-53-1 C28H39N5O8
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72

Copyright 2007©  ChemicalBook. All rights reserved.