ChemicalBook

A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z

Description CAS Number Molecular Formula
AC-ALA-PRO-ALA-PNA 61596-39-2 C19H25N5O6
AC-ALA-SER-GLN-TYR-ARG-PRO-SER-GLN-ARG-HIS-GLY-OH C55H85N21O18
AC-ALA-SER-THR-ASP-AMC C26H33N5O11
AC-ALA-ALA-OH 19245-87-5 C8H14N2O4
AC-ALA-OME 3619-02-1 C6H11NO3
AC-ALA-TRP-OH C16H19N3O4
AC-ALA-GLU-VAL-ASP-PARANITROANILIDE C25H34N6O11
AC-ALA-ALA-PRO-ALA-BETANA 102029-65-2 C26H33N5O5
AC-ALA-NH2 15962-47-7 C5H10N2O2
AC-ALA-GLU-OH 57282-74-3 C10H16N2O6
AC-ALA-SER-GLN-LYS-ARG-PRO-SER-GLN-ARG-HIS-GLY-OH 106128-98-7 C52H88N22O17
AC-ALA-GLN-VAL-ASP-PARANITROANILIDE C25H35N7O10
Ac-B-Ala-OH
AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
AAVALLPAVLLALLAKNNLKECGLY C126H217N31O32S
AAVALLPAVLLALLAKNNLKDCGLF C125H215N31O31S
a-Calcitonin Gene Related Peptide, human C163H267N51O49S2
AC-AKPFD-AMIDE C29H43N7O8
ABL2B Fusion Protein(SH3)
AC-ALPHA-BENZYL-4,6-O-BENZYLIDENE-MURAMIC ACID 19229-57-3 C25H29NO8
ABL2B, Recombinant, Human
AcalyphaIndicaDryLeaf
Acamprosate Ca
Acamprosate-d12 Calcium Trihydrate C10H14D12N2O11S2?Ca
Acamprosate calcium 77337-73-6 C10H20CaN2O8S2
Acamprosate-d3 Calcium C5H7NO4SD3 . 0.5Ca
ACAMPROSATE CALCIUM REFERENCE SPECTRUM EPY(CRM STANDARD)
Acamprosate-D3 Calcium Salt
ACAMPROSATE IMPURITY A3-AMINOPROPANE-1-SULPHONIC ACID EPY(CRM STANDARD)
7-MAC 56610-72-1 C24H24N6O4S2
AC-AO(C12)AEAAEKAAKYAAEAAEKAAKAO(C12)A-NH2 C131H224N32O37
ABL CYTOSOLIC SUBSTRATE C64H101N15O16
ACANTHOPANAXROOTEXTRACTPOWDER
AcanthopanaxExtract
Acanthopanax senticosus P.E
ABLE(R) C ELECTROPORATION-COMP CELLS
(A-caPhos)2 PdCl2 (CH3)2NC6H4P(C6H11)2PdCl2P(C6H4N(CH3)2)(C6H11)2
ABLE(R) K COMPETENT CELLS
ABLE(R) K ELECTROPORATION-COMP CELLS
ABLE(R) C COMPETENT CELLS
ABLE(R) K E COLI STRAIN
ABLE(R)C AND K E COLI STRAINS
ABLE(R) C E COLI STRAIN
AC-BETA-(3-PYRIDYL)-ALA-OET HCL C11H15ClN2O3
AC-BETA-ALA-OH 3025-95-4 C5H9NO3
AC-BETA-(2-THIENYL)-ALA-OH 83396-76-3 C9H11NO3S
AC-BETA-ENDORPHIN, BOVINE, CAMEL, OVINE
AC-BETA-ALA-OME 31295-20-2 C6H11NO3
Acaprazine 55485-20-6
ACARAGEL(TM)
ABL1 Fusion Protein(SH3)
ABL1 Fusion Protein (SH2)
ABL2 Fusion Protein (SH3)
Acarbose-D4 C25H39D4NO18
Acarbose 56180-94-0 C25H43NO18
AC-ARG-OH 2H2O 210545-23-6 C8H20N4O5
AC-ARG-GLU(EDANS)-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-LYS(DABCYL)-ARG-OH TRIFLUOROACETATE SALT C102H145F3N30O22S
AC-ARG-TYR-TYR-ARG-ILE-LYS-NH2 200959-48-4 C44H70N14O9
AC-ARG-PHE-MET-TRP-MET-ARG-NH2 C44H66N14O7S2
AC-ARG-NH2 SALT 64365-27-1 C8H17N5O2
AC-ARG-OET HCL 74802-30-5 C10H20N4O3
AC-ARG-LYS-ILE-LEU-PHE(4-NO2)-LEU-ASP-GLY-NH2 C47H78N14O13
AC-ARG-OME HCL 1784-05-0 C9H19ClN4O3
AC-ARG-ARG-PRO-TYR-ILE-LEU-OH 74853-69-3 C40H66N12O9
AC-ARG-NH2 2HCL 88530-28-3 C8H18ClN5O2
AC-ARG-ARG-LEU-ILE-GLU-ASP-ALA-GLU-PTYR-ALA-ALA-ARG-GLY-NH2 C66H110N23O24P
AC-ARG-GLY-LYS(AC)-AMC 660846-97-9 C28H40N8O7
AC-ARG-GLU-LYS-ARG-AFC C35H51N12O9F3
AC-ARG-CYS-GLY-VAL-PRO-ASP-NH2 158841-76-0 C27H46N10O9S
AC-ARG-GLY-PHE-PHE-PRO-7-AMINO-4-TRIFLUOROMETHYL COUMARIN C43H48F3N9O8
AC-ARG-PHE-PHE-PRO-LEU-MET-NH2 C42H62N10O7S
AC-ARG-ARG-TRP-TRP-CYS-ARG-NH2 138559-60-1 C45H66N18O7S
AC-ARG-PHE-MET-TRP-MET-THR-NH2 C42H61N11O8S2
Ac-Arg
AC-ARG-PHE-MET-TRP-MET-LYS-NH2 C44H66N12O7S2
AC-ARG(PMC)-OH 163277-77-8 C22H34N4O6S
AC-ARG-PNA HCL 40127-26-2 C14H21ClN6O4
Carotene 7488-99-5 C40H56
AAVHSSEEDLRTPPRPVSS C80H130N26O30
ACASIA OIL
ACAT-2
AC-ARTKQTARKSTGGKA-AMIDE C65H120N26O21
Abl, Human
Abl, Human (T315I)
ACAT-2 BLOCKING PEPTIDE
ACAT-1 BLOCKING PEPTIDE
N-Acetyl-L-asparagine 4033-40-3 C6H10N2O4
AC-ASN-TRP-CYS-LYS-ARG-GLY-ARG-LYS-GLN-CYS-LYS-THR-HIS-PRO-HIS-NH2 C81H128N32O19S2
AC-ASN(TRT)-OH 163277-78-9 C25H24N2O4
AC-ASN-CYS-THR-HIS-PRO-GLU-ASP-MET-LYS-LEU-CYS-THR C57H92N16O21S3
¦Â+A457-Casomorphin, human C44H61N7O11
AC-ASP-BD-ASP-CHO
AC-ASP-ARG-GLY-ASP-SER-OH C21H34N8O12
AC-ASP-GLN-THR-ASP-H (ALDEHYDE) C19H29N5O11
AC-ASP-OH CA SALT C6H7CaNO5
AC-ASP-ARG-LEU-ASP-SER-OH C25H42N8O12
AC-ASP-GLU-DIF-GLU-CHA-CYS-OH C43H56N6O14S
AC-ASP-MET-GLN-ASP-PNA C26H35N7O12S
AC-ASP-MET-GLN-ASP-7-AMINO-4-METHYLCOUMARIN C30H38N6O12S
Ac-Asp-Pro-Met-Ser-Ser-Thr-Tyr-Ile-Glu-Glu-Leu-Gly-Lys-Arg-Glu-Val-Thr-Ile-Pro-Pro-Lys-Tyr-Arg-Glu-Leu-Leu-Ala-NH2
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78

Copyright 2007©  ChemicalBook. All rights reserved.