ChemicalBook

A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z

Description CAS Number Molecular Formula
3A,11C-DIHYDRO-3H-BENZO[5,6]CHROMENO[4,3-C]ISOXAZOL-1(4H)-YL(1-ADAMANTYL)METHANONE C25H27NO3
3A,11C-DIHYDRO-3H-BENZO[5,6]CHROMENO[4,3-C]ISOXAZOL-1(4H)-YL[3-(2-CHLORO-6-FLUOROPHENYL)-5-METHYL-4-ISOXAZOLYL]METHANONE C25H18ClFN2O4
1-[3A,11C-DIHYDRO-3H-BENZO[5,6]CHROMENO[4,3-C]ISOXAZOL-1(4H)-YL]-2-MORPHOLINO-1-ETHANONE C20H22N2O4
3A,11C-DIHYDRO-3H-BENZO[5,6]CHROMENO[4,3-C]ISOXAZOL-1(4H)-YL(4-CHLOROPHENYL)METHANONE C21H16ClNO3
3A,11C-DIHYDRO-3H-BENZO[5,6]CHROMENO[4,3-C]ISOXAZOL-1(4H)-YL(2-THIENYL)METHANONE C19H15NO3S
1-[3A,11C-DIHYDRO-3H-BENZO[5,6]CHROMENO[4,3-C]ISOXAZOL-1(4H)-YL]-2-PIPERIDINO-1-ETHANONE C21H24N2O3
AC-DIISALVTSTFIIEKQPPQVLK-AMIDE C115H193N27O33
Ethyl 2-(acetylamino)-3-[3,5-diiodo-4-(4-methoxyphenoxy)phenyl]propanoate 83249-56-3 C20H21I2NO5
AC-DIMRVNVDKVLERDQKLSELDDRADALQAGASQFESAAKLKRKYWWKNLK-OH C261H422N76O79S
AC-3,5-DINITRO-TYR-OET 29358-99-4 C13H15N3O8
ACD/Index Name Pro
ACEA 273734-07-9 C22H36ClNO
ACD/IUPAC NAME GENERATOR
ACCUANGLE PROTRACTOR
ACCU3 ASSEMBLY
ACD/IUPAC Name Pro
ACE( ACE, testis-specific isoform precursor)
Accudenz A.G., Cell Separation Media
Ace addition funnel
AC-CTPYDINQM-AMIDE C47H72N12O16S2
ACCUFLUOR NFTH-AL2O3 BLEND 162241-33-0 C6H13B2F9N2O
ACCUGENE 5X TBE BUFFER
ACCUGENE 10X TRIS-GLYCINE
ACCUGENE 10X PBS
ACCUGENE 50X TAE BUFFER
ACCUGENE 10X TRIS-GLYCINE 1
ACCUGENE 1M TRIS-HCL BUFFER (PH 7.2)
ACCUGENE 10X MOPS BUFFER
ACCUGENE 20X SSPE
ACCUGENE 20X SSC
ACCUGENE SUPER BROTH
ACCUGENE MOL. BIO. WATER
ACCUGENE 1M TRIS-HCL BUFFER (PH 8.0)
ACCUGENE 1M TRIS-HCL BUFFER (PH 7.4)
ACCUGENE 10X TAE BUFFER
ACCUGENE WATER, MOLBIO
ACCUGENE LB BROTH
ACCUGENE 10X TRIS-GLY SDS
ACCUGENE 3M NA ACETATE
ACCUGENE 1X PBS
ACCUGENE NEUTRALIZE SOLN
ACCUGENE 5M NACL
ACCUGENE DENATURING SOLN
ACCUGENE 0.5M EDTA SOLUTION
ACCUGENE 0.5M EDTA
ACCUGENE 10 SDS
ACCUGENE 10X HS BUFFER
5'-ACCTTATGTATCATACACAT-3'
AC-DL-ARG-OH 2H2O 114005-77-5 C8H20N4O5
N-Acetyl-DL-aspartic acid 2545-40-6 C6H9NO5
Ace Allihn condenser
Acculab(R) Balance 220V Adapter
Acculab(R) GS Balance
Ace Allihn condenser with Ace-ThredTM hose connections
ACCUMAX(TM) PH 6.8-7.8
ACCUMULATOR PLATE
ACCUMATE(TM) DIFFERENTIATING SOLUTION
aceanthryleno[1,2-b]pyrazine-2,3-dicarbonitrile C20H8N4
1,2-ACEANTHRYLENEDIONE 6373-11-1 C16H8O2
¦Á-acctylbuty-¦Ã-lostone(abl)
AC-D-LEU-NH2 C8H16N2O2
Accu-Paque Lymphocytes, Mammalian & Fish, Cell Separation Media
Accu-Prep Lymphocytes, Human, Cell Separation Media
Accu-Prep Tubes
ACCURATE PH TEST PAPER, RANGE:8.2-10.0
ACCURATE PH TEST PAPER, RANGE:3.8-5.4
ACCURATE PH TEST PAPER, RANGE:6.9-8.4
ACCURATE PH TEST PAPER, RANGE:2.7-4.7
ACCURATE PH TEST PAPER, RANGE:9.5-13.0
ACCURATE PH TEST PAPER, RANGE:7.6-8.5
ACCURATE PH TEST PAPER, RANGE:0.5-5.0
ACCURATE PH TEST PAPER, RANGE:12.0-14.0
ACCURATE PH TEST PAPER, RANGE:1.4-3.0
ACCURATE PH TEST PAPER, RANGE:6.4-8.0
ACCURATE PH TEST PAPER, RANGE:5.5-9.0
AC-DL-HIS-OH H2O 213178-97-3 C8H13N3O4
ACCURATE WEIGHT / PESEE PRECISE
AC-DL-ILE-OH C8H15NO3
ACCUSPINTM Tubes Nonsterile, 50 mL Capacity
ACCUSPINTM Tubes Sterile, 12 mL Capacity
ACCUSTAIN(R) FORMALIN FREE FIXATIVE
ACCUSPINTM Tubes Sterile, 50 mL Capacity
ACCUTAQ(TM) LA DNA POLYMERASE
Accu-TUF (Target Unmasking Fluid), 10X, for Antigen Retrieval in paraffin/cryostat & cytological spec.
Accutray
AccuTaqTMLA 10¡Á Buffer
ACCUTAQ(R) LA 10X BUFFER
ACCUTASE PH 6.8-7.8
Ace auto-zero Mcleod vacuum gauges
AC-DL-LYS (AC)-OH 35436-74-9 C10H18N2O4
AC-DL-LYS(Z)-NH2 C16H23N3O4
AC-DL-3'-METHYLPHE-OET C14H19NO3
AC-DL-4'-METHYLPHE-OET C14H19NO3
AC-DL-MET-OME 7451-74-3 C8H15NO3S
AC-DL-NVA-OH 7682-15-7 C7H13NO3
AC-DL-2-NAL-OH C15H15NO3
AC-DL-4'-NITROPHE-OET 198152-46-4 C13H16N2O5
ACD/LogP DB
ACE, BOVINE
N-Acetyl-D-methionine 1509-92-8 C7H13NO3S
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81

Copyright 2007©  ChemicalBook. All rights reserved.