ChemicalBook

129203-60-7(IBERIOTOXIN) Product Description

IBERIOTOXIN Structure
129203-60-7
CAS No.129203-60-7
Chemical Name:IBERIOTOXIN
CBNumber:CB8130448
Molecular Formula:C179H274N50O55S7
Formula Weight:4230.85
MOL File:Mol file
IBERIOTOXIN Synonyms:

iberiotoxin from buthus tamulus
IBERIOTOXIN FROM BUTHUS TAMULUS, 50 UG*
IBERIOTOXIN 98%
IBERIOTOXIN, RECOMBINANT
M.W. 4230.91 C179H274N50O55S7
IBERIOTOXIN
IBERIOTOXIN, BUTHUS TAMULUS
IBERIOTOXIN SCORPION BUTHUS TAMULUS

IBERIOTOXIN Property

storage temp. : −20°C
solubility : H2O: 1 mg/mL, clear, colorless
Safety
Hazard Codes : T+
Risk Statements : 26/27/28
Safety Statements : 28-36/37-45
RIDADR : UN 3462 6.1/PG 2
WGK Germany : 3
RTECS : NH6107500
F : 3-10
IBERIOTOXIN Suppliers      Global( 25)Suppliers     
SupplierTelFaxEmailCountryProdListAdvantage
3B Pharmachem International (Wuhan) Co.,Ltd. 86-027-87785560£¨0)1562309216786-027-87526527hunter.wu@3bsc.comCHINA 3259 40
MOLEKULA Ltd. +44 (0) 1747 831066+44 (0) 1747 831199kevinbanks@molekula.comUNITED KINGDOM 33519 46
SIGMA-RBI 800 736 3690 (Orders)+41 81 756 54 49NULLSWITZERLAND 75658 91
Nanjing Chemlin Chemical Co., Ltd +86-25-83697070+86-25-83453275sales@chemlin.com.cnCHINA 109933 56
Beijing TianLi Biological Chemical Co., Ltd. 01086181995 01089124423 waley188@sohu.comCHINA 44232 47
Guangzhou WeiBo Chemical Co., Ltd. 020-33640779 32416961020-26277554weibochem@163.comCHINA 59570 67
Accurate Chemical & Scientific Corporation. 516-333-2221 ,1-800-645-6264(TOLL FREE)516-997-4948sanbio@sanbio.nlUSA 14748 72
Service Chemical Inc. 888-895-6920215-362-2578sales@chemos-group.comGERMANY 69964 71
 
129203-60-7(IBERIOTOXIN) Related Search:
Voltage-gated Ion Channels iberiotoxin from buthus tamulus Ion Channel Modulating Peptides Potassium Channel ModulatorsPeptides for Cell Biology Potassium channel IBERIOTOXIN FROM BUTHUS TAMULUS, 50 UG* IBERIOTOXIN 98% IBERIOTOXIN, RECOMBINANT Monovalent Ion Channels Potassium Channel ModulatorsCell Signaling and Neuroscience Scorpion Toxins and Venoms Voltage-gated Ion Channels C179H273N49O56S7 Enzyme Inhibitors Enzyme Inhibitors by Type Other M.W. 4230.91 C179H274N50O55S7 129203-60-7 IBERIOTOXIN IBERIOTOXIN, BUTHUS TAMULUS IBERIOTOXIN SCORPION BUTHUS TAMULUS IBTX IBTX (SCORPION, BUTHUS TAMULUS) PGLU-PHE-THR-ASP-VAL-ASP-CYS-SER-VAL-SER-LYS-GLU-CYS-TRP-SER-VAL-CYS-LYS-ASP-LEU-PHE-GLY-VAL-ASP-ARG-GLY-LYS-CYS-MET-GLY-LYS-LYS-CYS-ARG-CYS-TYR-GLN [DISULFIDE BRIDGES: 7-28, 13-3, 17-3] PYR-FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ PYR-FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(DISULFIDE BRIDGE: C7-C28,C13-C33,C17-C35) PYR-PHE-THR-ASP-VAL-ASP-CYS-SER-VAL-SER-LYS-GLU-CYS-TRP-SER-VAL-CYS-LYS-ASP-LEU-PHE-GLY-VAL-ASP-ARG-GLY-LYS-CYS-MET-GLY-LYS-LYS-CYS-ARG-CYS-TYR-GLN PYR-PHE-THR-ASP-VAL-ASP-CYS-SER-VAL-SER-LYS-GLU-CYS-TRP-SER-VAL-CYS-LYS-ASP-LEU-PHE-GLY-VAL-ASP-ARG-GLY-LYS-CYS-MET-GLY-LYS-LYS-CYS-ARG-CYS-TYR-GLN-OH PYR-PHE-THR-ASP-VAL-ASP-CYS-SER-VAL-SER-LYS-GLU-CYS-TRP-SER-VAL-CYS-LYS-ASP-LEU-PHE-GLY-VAL-ASP-ARG-GLY-LYS-CYS-MET-GLY-LYS-LYS-CYS-ARG-CYS-TYR-GLN-OH (DISULFIDE BRIDGE: C7-C28,C13-C33,C17-C35) RLBTX Potassium Channel Modulators Other Cell Biology Cell Signaling and Neuroscience Biochemicals and Reagents Enzyme Inhibitors by Type Enzyme Inhibitors Enzymes, Inhibitors, and Substrates Monovalent Ion Channels Ion Channels BioChemical
Copyright 2007 © ChemicalBook. All rights reserved