ChemicalBook

C31 Product Description

C31 Structure
CAS No.
Chemical Name:C31
CBNumber:CB7228397
Molecular Formula:C162H243N45O52S2
Formula Weight:3717.06
MOL File:Mol file
C31 Synonyms:

H-ALA-ALA-VAL-THR-PRO-GLU-GLU-ARG-HIS-LEU-SER-LYS-MET-GLN-GLN-ASN-GLY-TYR-GLU-ASN-PRO-THR-TYR-LYS-PHE-PHE-GLU-GLN-MET-GLN-ASN-OH
CTF-31
C31
APP770 (740-770)
APP740-770
AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
AMYLOID BETA/A4 PROTEIN PRECURSOR770 (740-770)

C31 Property

Safety
C31 Suppliers      Global( 1)Suppliers     
SupplierTelFaxEmailCountryProdListAdvantage
EMD Biosciences, Inc. 858 450 5500858 450 9600technical@calbiochem.comUSA 7550 66
 
C31 Related Search:
H-ALA-ALA-VAL-THR-PRO-GLU-GLU-ARG-HIS-LEU-SER-LYS-MET-GLN-GLN-ASN-GLY-TYR-GLU-ASN-PRO-THR-TYR-LYS-PHE-PHE-GLU-GLN-MET-GLN-ASN-OH CTF-31 C31 APP770 (740-770) APP740-770 AAVTPEERHLSKMQQNGYENPTYKFFEQMQN AMYLOID BETA/A4 PROTEIN PRECURSOR770 (740-770)
Copyright 2007 © ChemicalBook. All rights reserved